Election 2012 Federal Crime Victims Plead Public Safety Intervention Shop Class Action Law Firms

Roxanne Grinage Shows Future Presidents Build This Schematics Economy Education Court Reform Now!

Roxanne Grinage Job Interview Funding Pitch American Jobs Creation Societal Preservation

Citizens Public Docket Names Philadelphia DHS Lawyer Malpractice Child Slaughter Officials

Battle Cry America Is Coming For Our Children Lorraine Grinage mother of 06/08/10 Erick Brown Saundra O Sullivan Diane Kearney Andrew and Darren Sullivan Public Mob Assault Abducted Ezekiel and Arriyel Brown's Spoken Word Testimony evidence hand delivered by Roxanne Grinage to U.S. Attorney Eastern District of Pennsylvania Zane David Memeger on November 9, 2010.

Forever referred to by historians as Champions of Patriotism Quotes Roxanne Grinage August 02, 2011 Letter to President Barack Obama, U.S. Attorney Eric Holder, Office of Civil Rights Regions Enclose HireLyrics Administrative Services Evidence RICO and Title 18 Indictable Judges Social Workers, Lawyers, Psychological Evaluators and Elected Officials Indicated Need For Presidential and Justice Department Intervention to Protect National Security Public Safety Emergency Posed by a Nationwide Child Slaughter U.S. Economy Fraud Court and Education Public Safety State of Emergency. responsibly recorded respectfully reported, Roxanne Grinage, Legal Administrative Assistant HireLyrics Administrative Services U.S. Citizens (controlled) Public Docket Database Grinage Family Private Investigation Rescue 060810 Abusive Parent Mob Assault Abducted Ezekiel and Arriyel Brown, PO Box 22225 Philadelphia Pa 19136, www.HireLyrics.org www.BlogTalkRadio.com/Born-To-Serve, Toll Free (888) 589-1110, Free Call North America Skype (215) 395-6985, Fax: (215) 405-2939 RoxanneGrinage@Yahoo.com or DignityForTheHumanSpirit@HireLyrics.org

Free Download Re-posted 10/20/11 Build This! Roxanne Grinage 11 years Prototype Demonstrated Standard Access Practice Model Schematics Reported at Fifth Anniversary 2005 birthed Administrative Solutions Tool U.S. Citizens controlled Public Docket Database Corruption in Government Clean Up Child Slaughter U.S. Economy Fraud Court Education Reform Public Safety Emergency.pdf

11/28/10 "Intelligence Collections Analysis Methodologist Expert Witness James Roger Brown Criteria Based Definition Best Interest of Child, Legislative Language Petitions, IMMD-2 Mental Health Exam Fraud Attorney Generals Consumer Complaints compile 20,000 complaints per state million nationwide class action, Data Analysis Child Slave Project.wma" https://docs.google.com/leaf?id=0B89iePTz33VFOWRlMGE3YjUtOWQ3Mi00NTJhLThhMTYtMzdkMTY5NzFiNDU2&hl=en_US 071411 Roxanne Grinage HireLyrics Standard Access Claims Intake Assessment Pennsylvania Philadelphia Family Court Appointed Lawyer Lies About Grandparents Standing Facilitate 112th DHS Demonic Horror Story Kidnap Injuries Four Generations Thomas Family Ada Janette Gladys Janaya Victoria Jermya Ikee Thomas.wma https://docs.google.com/leaf?id=0B89iePTz33VFMmQ0YzYxOWQtZjk3Zi00MzRmLTkzZGEtODUwODJhM2VmZDA5&hl=en_US

052911 Roxanne Grinage Explains Administrative Solutions in U.S. Citizens controlled Public Docket Database For Law Abiding American Federal Crime Victims of Family Court with DHS Kidnap For Profit Schemes evolved because of the official corruption fraud civil rights crimes which occurred in Roxanne Grinage v Fern Brown Caplan, Esquire, Timothy E. Possenti, Esquire and Brownson Ezekiel Brown and Arriyel Brown v Judge Robert J Matthews and Anne Marie Ambrose in their individual criminal capacities for having stolen $6.2 Million Vested Interest Career Theft from Roxanne Grinage dba HireLyrics Administrative Services and Ezekiel and Arriyel Brown and Lorraine Grinage v Erick Brown and Saundra Sullivan 121310 Aggravated Assaults on minors while in the commission of SSI Fraud Insurance Fraud Bigamy Perjery and 060810 Public Mob Assault Child Abductions of Lorraine Grinage’s children while fleeing services of Federal and Philadelphia District Attorney Services of Summons, USDC PaED 209cv04119MSG 209cv05448BMS 209cv00179MSG.wma  https://docs.google.com/leaf?id=0B89iePTz33VFMzI4NDg2OTctNjVlZS00Y2I4LWJjYTQtNzkzYjc2NDNmNzdi&hl=en_US

053111 Special Prosecutor Intervention Audit Review Requested 070610 Filing Figure 1 Docket Discrimination Analysis U.S.D.C. Paed 209cv04119MSG Roxanne Grinage v Fern Brown Caplan Esquire et al.doc (289 KB) 7:21 am by HireLyrics Download

052711 SCHEDULE C U.S. Citizens controlled Public Docket Citizens Video Journalism Public Post Incident Reports HireLyrics Administrative Services Roxanne Grinage Family Rescue Ezekiel Arriyel Brown.doc (2 MB) 4:53 pm by HireLyrics.org Download

021311 IRS PACSES USM285 USDOA USDC Notices Grinage Family Rescue Ezekiel Arriyel Brown Philadelphia Family Court DHS Malpractice Judge Robert Matthews Kevin Dougherty Anne Ambrose Erick Brown 060810 Mob Assault Abduction Fraud.pdf

012311 Confidential Distribution List Redacted Roxanne Grinage HireLyrics Checklist Proposal Management Team Invitations First Draft Business Plan Nonprofit Federal Crime Victim Voters Safe Haven DHS Abused Runaways.pdf

DMCA Copyrights Owned by Roxanne Grinage. Pics and audio being formatted for upload coming soon. Federal Crime Victim Voters Education Rallies and April 1st Bullhorns Neighborhoods Citizens Campaigns Ensure No Second Term Michael Nutter's DHS Courtroom Killing Floors.

053111 Special Prosecutor Intervention Audit Review Requested 070610 Filing Figure 1 Docket Discrimination Analysis U.S.D.C. Paed 209cv04119MSG Roxanne Grinage v Fern Brown Caplan Esquire et al.doc (289 KB) 7:21 am by HireLyrics Download

052711 SCHEDULE C U.S. Citizens controlled Public Docket Citizens Video Journalism Public Post Incident Reports HireLyrics Administrative Services Roxanne Grinage Family Rescue Ezekiel Arriyel Brown.doc (2 MB) 4:53 pm by HireLyrics.org Download

010211 Free Sign Up Form Roxanne Grinage HireLyrics Toll Free 888-589-1110 $1 Billion Class Action Campaign 2012 Galvanize Voter Clout Federal Crime Victims Pa Constitution Citizens Grand Juries Safe Haven DHS Court Abused Runaways.pdf

Print fill in and fax back the second page of this pdf file if you want us to contact you to verify your claim to join class action lawsuit 70 families and growing plan to sue City of Philadelphia DHS and certain Philadelphia Family Court Judges with Certain Named City Solicitors Child Advocates Commissioner Case Workers. See Roxanne Grinage HireLyrics Mar 15 2011 Metro Philly Ad. Fax completed form back to 215-405-2939. Leave your victim testimony on toll free number only (888) 589-1110. Contact RoxanneGrinage@Yahoo.com if you can by email. The name of this pdf document in case you are searching online is See Roxanne Grinage HireLyrics Mar 15 2011 Metro Philadelphia Newspaper Ad Fax Free Form 215-405-2939 Call 888-589-1110 Join 70 Families Plan $1 Billion Lawsuit No 2nd Term Nutter DHS Family Courtroom Killing Floors Must Close.pdf

Print fill in and fax back the second page of this pdf file if you want us to contact you to verify your claim to join class action lawsuit 70 families and growing plan to sue City of Philadelphia DHS and certain Philadelphia Family Court Judges with Certain Named City Solicitors Child Advocates Commissioner Case Workers. See Roxanne Grinage HireLyrics Mar 15 2011 Metro Philly Ad. Fax completed form back to 215-405-2939. Leave your victim testimony on toll free number only (888) 589-1110. Contact RoxanneGrinage@Yahoo.com if you can by email. The name of this pdf document in case you are searching online is See Roxanne Grinage HireLyrics Mar 15 2011 Metro Philadelphia Newspaper Ad Fax Free Form 215-405-2939 Call 888-589-1110 Join 70 Families Plan $1 Billion Lawsuit No 2nd Term Nutter DHS Family Courtroom Killing Floors Must Close.pdf

http://ireport.cnn.com/docs/DOC-564973 See Full Length 33min video what happened 02/28/2011 when New Civil Rights Movement New Civil Rights Heroes Families Fight Back Say No More DHS Demonic Horror Stories, Janice Brown, Maurice West, Roxanne Grinage reviewed the records ordered produced by Subpoena upon DHS City of Philadelphia Deputy Solicitor Barbara A. Ash – an historic event in turning the tide for a so far unaccountable Philadelphia Family Court with DHS agency daily kidnap for profit child slaughter, theft of heritage, religious freedoms, forced commerce, siphoned embezzled federal and state funds by deliberate or  incompetent falsification of records and lying in official court documents:  Child Abuse Registry Fraud; Child Support Enforcement Fraud; Mental Health Exam Fraud; unlawful attachments, double and triple billing, etc. at CNN iReport HireLyrics Roxanne Grinage http://ireport.cnn.com/docs/DOC-564973

A management team of Federal Crime Victim Voters created by State Court Conflict of Interest with DHS malpractice will organize the endorsement and impeachment clout of a tragically far too large voter constituency while we create jobs in our community that do what our elected officials have failed to do – protect public safety, educate, make referrals to ethical litigators and claims processes; transmit Fraud Reports and Recovery Act Fraud and Waste Whistleblower transmittals; honor our Commonwealth, States’ and U.S. Constitutions; and provide constitutionally correct People’s Protection Safe Haven for DHS and Court Ordered Abused Runaways.  I commit every resource I have including ten and half years demonstrated standard access mechanism Roxanne Grinage dba HireLyrics Administrative Services to the rescue of my grand children which I believe hinges on DHS slaughtered families ceasing to be reactive (the nature of a DHS Demonic Horror Story Assault is to Disorient Confuse and Dismay); determine and navigate our own course; fuel our own momentum; speak and show up in tragically large one body one voice – millions slaughtered.  Because my family’s salvation rests in recognizing those with a common purpose passion commitment and ability, I believe in my vision that a personality independent standard access to fair entry into competitive processes, i.e., the New Civil Rights Movement fight for human lives; U.S. and Commonwealths and States’ economy is needed to amplify the voice of the systematically silently slaughtered victim American family. If one of us should fall, or ten of us should fall or a hundred of us should fall…we WILL have a community-needs powered personality independent mechanism in place that will repetitively trigger  standard access to the rescue of children of all ages injured by the child selling schemes of official corruption fraud civil rights felonies inflicted.

03/28/11 Donations needed All Neighbors and Community Welcome Meeting Place where anyone can come regardless of who you know or what you have, share learning, network solutions for rescuing the soul of our cities, our commonwealths, our nation:  Federal Crime Victim Voters Safe Haven DHS Abused Runaways.  No Second Term Michael Nutter Daily DHS Philadelphia Family Court Child Slaughter Must End.  Purchase a Tee Shirt Donations pay for Metro Philly Daily News Philadelphia Inquirer Print Ads, Television and Radio Ads, Donation Buttons at www.HireLyrics.org

Administrative Costs for maintaining a place where anyone is welcome no matter who you know or what you have to share learning network strategize lawful solutions for slowing Child Slaughter U.S. Economy Fraud Court and Education Reform Emergency while we rescue the soul of our Cities, Our Commonwealths, Our States, Our Nation.  https://docs.google.com/leaf?id=0B_UmvYpq4WCUNjlmZGM0MjctNWNhMi00YWFiLTk5MjgtMDRkNTQ1ZDhjYjI1&hl=en  

See Too Many Pics and iGoogle document links to fit here and complete blog posts http://HireLyrics.org.  Roxanne Grinage Hosts HireLyrics is Born To Serve on Blog Talk Radio where we meet Sundays at 11:00 A.M. EST to share administrative solutions for market entry challenges for the previously un-accommodated population of disadvantaged creators. http://BlogTalkRadio.com/Born-To-Serve.  Leave your verifiable testimony about your Family Court with DHS Malpractice inflicted crimes against your American family toll free (888) 589-1110.  Fax your documents to (215) 239-1110.  Roxanne Grinage will verify and play on HireLyrics is Born To Serve on Blog Talk Radio whose show urls are submitted to the official contact forms of USDOJ, Whitehouse, Lawmakers, Prosecutors, Funding Sources, Media and ethical people who are in a position to intervene and help slow U.S. Citizens Public Docket responsibly recorded respectfully reported Child Slaughter U.S. Economy Court and Education Reform State of Emergency.

Roxanne Grinage Respectfully Suggested Administrative Solutions
Child Slaughter U.S. Economy Fraud Court and Education Reform State of Emergency

The answer to missed educational opportunities; oppressive contracts and unaccountability horror stories; racism; poverty; and hate-based ideas festering into terrorism, is the responsible development of entities that standardize access, standardize procedures, and standardize services.  Respectfully, -roxanne grinage-

“Take no bag for the journey, or extra tunic or sandals or a staff; for the worker is worth his keep.”
Matthew 10:10

Roxanne Grinage, HireLyrics Administrative Services, U.S. Citizens (controlled) Public Docket Database, Grinage Family Rescue Ezekiel Arriyel Brown
PO Box 22225, Philadelphia PA 19136
Toll Free (888) 589-1110                   Fax:  (215) 589-2939
Email:  RoxanneGrinage@Yahoo.com and/or DignityForTheHumanSpirit@HireLyrics.org
http://Facebook.com/Roxanne.Grinage            http://Twitter.com/HireLyrics
http://YouTube.com/HireLyrics           http://YouTube.com/WhatIsThereLeftToDo
http://YouTube.com/RoxanneGrinage

HireLyrics™ is a litigation referral administrative services company that raises quality of life by providing standard access to those administrative services that when rendered contingently cause fair entry into competitive processes; exposure and earnings opportunities for the previously unseen, unmeasured un-accommodated Worldwide Population of Disadvantaged Creators©. What are Disadvantaged Creators© Creating?....Work Product and Career Contributions, Families, Communities, Education, Technology, Entertainment, Engineering, Military and Defense, Health care Medicine and Science, Twelve Step Recovery, Life Experience and Mentorship, etc.

What is Done in The Dark is Coming to Light as Sun Shines on a darkened gloomy Philadelphia City Hall.jpg What is done in the dark will come to light.  Federal Investigation, choking funding Corruption Plagued PHA clean up, DHS slaughtered families speaking in one voice millions slaughter using lawful evidence gathering depositions and expert witness testimony to document Kidnap For Profit schemes of Judge Kevin M Dougherty who told Janice Brown “I’m concerned about how much loss of family members you have suffered” and then proceeded to work with DHS City Solicitors Lyris Younge and Barbara A Ash to falsify records to cause infliction of further suffering illegal adoption kidnap for profit trauma theft of heritage religious freedoms and possible forced chemicals injuries inflicted on Envy Smith and Zyeem Hill, Janice Brown’s grandchildren.  https://docs.google.com/leaf?id=0B_UmvYpq4WCUMjhjNTU3YWYtZjAzOC00MThmLTg4MjItNTIyY2NmYmQyYTNi&hl=en  

030111 Roxanne Grinage HireLyrics Fifty Families Sign Up $1B Class Action No 2nd Term Michael Nutter Philadelphia Family Courtroom Killings Floors Must Close.gif
https://docs.google.com/leaf?id=0B_UmvYpq4WCUNGNkZjliNTgtOTI0Ni00Y2M3LWEwZDAtNGMzMWRhNjVhZjJk&hl=en  

030111 Roxanne Grinage HireLyrics US Citizens Public Docket Administrative Solutions slow Child Slaughter US Economy Court Education Reform Emergency.jpg.gif (89 KB)
https://docs.google.com/leaf?id=0B_UmvYpq4WCUZWE3YjdmN2ItY2M2OS00NWUyLWIwMTEtMTFlNTVjZDllMDZj&hl=en  

022811 Janice Brown Feltonville Crash Grandmother receives threat of DHS Retaliation to Remove remaining grandchild for proving DHS City of Philadelphia City Solicitors Lyris Younge, Barbara A. Ash, Judge Kevin M. Dougherty’s illegal adoptions for profit schemes by way of Deliberate Records Mis-Management.  Janice Brown, Maurice West, Deborah Young and Roxanne Grinage did place in the hands of Barbara A. Ash, Deputy City Solictor signed witness statements re Subpoenaed Records Reviewed the following:  Barbara Ash has been left with Notice of Fifty Families $1 Billion Class Action Personal Injuries inflicted by DHS with Philadelphia Family Court.  02/28/2011.  This notifies [that] Janice Brown Maurice West Deborah Young Roxanne Grinage did come in person to DHS 1515 Arch and did confirm in person conversation with Barbara Ash, Chief Deputy City Solicitor (1) Barbara Ash did not produce records pertaining to Envy Smith and Zyeem Hill; (2) Did not produce any Deposition Petition or reason(s) for transport transfer guardianship and (3) Barbara Ash did produce falsified records / old case notes altered to appear as recently entered false statements unsbstantiated.  No record was produced to support transport, or adoption of Janice Browns grandchildren.  Signed Janice Brown, Signed Maurice West, Signed Deborah Young, Signed Roxanne Grinage.  DHS Records Mismanagement Error noted at time of paying for and picking up 55 pages copied by DHS employee was that another family another DHS case number completely unrelated to Janice Brown Envy Smith Zyeem Hill Subpoenaed Records incompletely produced - indicated on City of Philadelphia DHS Letterhead Responsible Management showing Raydell Fisher-Wilson, Legal Assistant Supervisor Law Department Child Welfare Unit, One Parkway Building, 1515 Arch Street, 16th Floor, Philadelphia, PA 19102-1595, (215) 683-5158 Fax (215) 683-5162 RAYDELLFISHER@PHILA.GOV did present receipt with reinforced theft of heritage separation trauma injuries suffered by Janice Brown's grandchildren for 3 and 1/2 years by inserted false record Re: DHS Case Name: Smith Robert, DHS File No. 183646D.  https://docs.google.com/viewer?a=v&pid=explorer&chrome=true&srcid=0B_UmvYpq4WCUYTRjYWY4OWEtYzFjNS00NmIzLTg4NDAtNmYyYzFkODU3ZTE0&hl=en  

022811 City Philadelphia DHS time cards Time clock seen in reception area records review – It’s a job – what length will unethical people go to keep a job?.jpg  https://docs.google.com/leaf?id=0B_UmvYpq4WCUN2I1YTM2ODYtY2FhMi00MDc0LTgwYTAtM2Y4ZWY0MmIyM2M3&hl=en  

022811 DHS Records mis-management kidnapped for profit stolen heritage stolen futures theft of religious freedoms DHS People Lives piled up scattered on the Floor like garbage 1 of 3.jpg  https://docs.google.com/leaf?id=0B_UmvYpq4WCUYjhlY2FmZGUtZTAyZi00MGEzLTlhMzMtOTdlZjUyN2ViZDFl&hl=en  

022811 Records mis-management kidnapped for profit stolen heritage DHS Files People Lives Scattered on the Floor like garbage 2 of 3.jpg  https://docs.google.com https://docs.google.com/leaf?id=0B_UmvYpq4WCUZDcyNzFiYWItNmU1Yi00NTFhLWE2NzQtMGI1MTE4NzBhN2Zm&hl=en

022811 DHS kidnap for profit heritage futures religious freedoms stolen stacked in boxes stored and forgotten 3 of 3.jpg 
https://docs.google.com/leaf?id=0B_UmvYpq4WCUYTk5ZWRlMDctZWE4ZC00M2FhLThkZDMtNzAyNGZiNDQ0YTk0&hl=en

022811 Deborah Young notes incomplete misfiled records in front of Maurice West points out dust laden law books never opened by DHS.jpg  https://docs.google.com/leaf?id=0B_UmvYpq4WCUMmJkOGRjMmUtOWQyYS00YTY2LWE5M2YtZTliZDU4NThiMTQ1&hl=en  

022811 gif Federal Crime Victim Voters Created by DHS Slaugher Vote Sign Up 1 Billion Class Action.gif (1 MB)9:20 https://docs.google.com/leaf?id=0B_UmvYpq4WCUZGU4ZDNkZDMtZGMyOS00OTRlLTk4NTctYTc0N2ZkYjkxNjY4&hl=en  

022811 Janice Brown Deborah Young recognize DHS falsified records and records of other families not related in her file and incomplete records produced by DHS City Solicitor subpoenaed Barbara A. Ash no deposition petition whatsoever.jpg https://docs.google.com/leaf?id=0B_UmvYpq4WCUOTYxNjYyZjEtOGM2Mi00Y2UzLWJjNGQtNWExNWVjYzM0YjNl&hl=en

Deborah Young Maurice West Janice Brown 1 Billion Class Action Statement on way DHS Subpoenaed Records Review illegal adoption.jpg (126 KB)
https://docs.google.com/leaf?id=0B_UmvYpq4WCUZmRjZjk0MzctYjc0NS00MTE5LWE1NjktNjIxMDgwN2M3NjI4&hl=en   

See how families are using docket monitoring and lawful policies and procedures of Federal Agencies to prove Judge Kevin M. Dougherty’s willful participation in defrauding Pennsylvania and Philadelphia Child Support Enforcement and Recovery Act CPS funding. 

021311 IRS PACSES USM285 USDOA USDC Notices Grinage Family Rescue Ezekiel Arriyel Brown Philadelphia Family Court DHS Malpractice Judge Robert Matthews Kevin Dougherty Anne Ambrose Erick Brown 060810 Mob Assault Abduction Fraud.pdf https://docs.google.com/viewer?a=v&pid=explorer&chrome=true&srcid=0B_UmvYpq4WCUODdkMzVlYmMtZTIyYS00MGZjLTk3NjMtZTMzMDc4ZjEwYjFl&hl=en

12/12/2009 Grinage Family Rescue Ezekiel Arriyel Brown will never forget the Laurel and Hardy Whose on First What’s on Second Anne Marie Ambrose Lied about in 18 page email stating DHS workers responded to the recorded bragged about by Saundra O. Sullivan beatings of Ezekiel Zadkiel Brown, Cracking Sounds, threats “yeah I’m hitting them now bitch what you going to do about It?” the screams of Ezekiel and Arriyel’s non stop crying heard in the background over 7 hours.  And then Anne Marie Ambrose’s censoring as though never received by DHS the 10/08/09 IMMD social worker Jacinta Garrison’s delivered proofs Sergeant read outloud high levels of cocaine speed and pcp drug test submitted by Timothy Possenti to Fern Brown Caplan to cause the 13 felonies inflicted Willful Reckless Child Endangerment of Roxanne Grinage’s grandchildren for the sake of greed extortion and bribes proven.  https://docs.google.com/fileview?id=0BwkY4FQWX-6pZGQ5NWIyYWEtZWFkMi00OGZhLWIwNzItN2QzNzJlMGJkYzYz&hl

Shoulder to Shoulder Deborah Young Janice Brown Maurice West Lead Way Fifty Families want to see records of stolen heritage DHS 1 Billion Class Action 22811.jpg (56 KB
https://docs.google.com/leaf?id=0B_UmvYpq4WCUNjNhMWMwZTAtNTY5YS00OTA2LWIzYTQtNDNjNzA5NDY3YmI1&hl=en  

022711 Charles Stecker Jr commemorates 44th anniversary death 2 year old Edward J. Stecker Murdered the Philadelphia DHS foster contractor who was trusted to help.  Edward Stecker was two years old and found out a Philadelphia Inquirer Article reported the same woman that murdered his two year old brother and shatter Edward's 4 year old arm was in fact under investigation for another child having died ten months before in the same foster "mother's" house: reformatted for TK official DC Rally Fest.gif (134 KB)
https://docs.google.com/leaf?id=0B_UmvYpq4WCUNjUwZGFkOGEtZTRiZi00ZTE2LTkwOWYtZDE5OGVhYmU2Yjhi&hl=en  

HireLyrics 1074 Citizens Docket Federal Crime Victim Voters Join Save Internet SOPA Blackout HireLyrics U.S. Citizens (controlled) Public Docket Database 1,074 Federal Crime Victim Voters verified support "Save The Internet Event SOPA Blackout" 01/18/2012.  After attending 01/17/12 Webcast Save The Internet Event Roxanne Grinage has authorized 30 Standard Access to Claims Intake Assessment Case Study pages at www.HireLyrics.org locked.  Imagine if American working class student and impoverished families and small business owners seeking lawful but assertive strategies for measuring and leveraging individual accountability for official corruption fraud civil rights crimes lost the quality of life enhancing free and low cost collaboration strength providing by internet technologies to learn we are a tragically far too large class of claimants holding untapped revenues whose U.S. Economy enriching careers contributions are missing or unfairly siphoned due to indvidually measureable acts of official corruption fraud and civil rights crimes.  SAVE THE INTERNET SO THAT THE VOTER CLOUT TO MAKE THIS WORLD A BETTER PLACE OF THE FEDERAL CRIME VICTIM VOTERS CREATED BY OFFICIAL CORRUPTION FRAUD CIVIL RIGHTS CRIMES IN ACCORDANCE WITH U.S. ATTORNEY'S DEFINITION OF SAME CAN HAVE AN INTERNET TECHNOLOGIES ENABLED "ALL NEIGHBORS WELCOME COMMUNITY MEETING PLACE - WHERE ANYONE IS WELCOME REGARDLESS OF WHO WE KNOW OR WHAT WE HAVE - WHERE OUR STRENGTH IS IN OUR ABILITY TO COLLABORATE NETWORK LAWFUL BUT ASSERTIVE SOLUTIONS FOR SAVING THE SOUL OF OUR CITIES, OUR STATES INDEED FOR SAVING THE SOUL OF OUR NATION." FEDERAL CRIME VICTIM VOTERS STATEMENT:  IF ONE OF US SHOULD FALL...OR TEN OF US SHOULD FALL...OR A HUNDRED OF US SHOULD FALL...WE WILL HAVE A COMMUNITY NEEDS POWERED PERSONALITY INDEPENDENT MECHANISM IN PLACE WHICH WILL AUTOMATICALLY TRIGGER THE RESCUE OF CHILDREN OF ALL AGES KIDNAP FOR PROFIT INJURED BY OFFICIAL CORRUPTION FRAUD CIVIL RIGHTS CRIMES. - STRONGEST PRAYERS, ROXANNE GRINAGE, WWW.HIRELYRICS.ORG  IMAGINE THE QUALITY OF LIFE, EDUCATION U.S. ECONOMY AND PUBLIC SAFETY EMERGENCY POSED BY FEDERAL CRIME VICTIM VOTERS AMERICAN WORKING CLASS STUDENT AND IMPOVERISHED CITIZENS VICTIMS OF OFFICIAL CORRUPTION FRAUD CIVIL RIGHTS CRIMES NOT BEING ABLE TO SEE AND SHARE THE LEARNING THAT RESULTS RESULTS IN "SHARING LEARNING RESULTS IN COMMUNITY COURAGE AND INCREASED QUALITY OF LIFE HRIELYRICS SHARES OUR LEARNING". ROXANNE AUTHORIZED 30 CLAIMS INTAKE ASSESSMENT VERIFIED CLAIMS PER JURISDICTION AND SIMILARLY SITUATED CLASS OF CLAIMANTS CASE STUDY PAGED LOCKED TO SIMULATE THE HORROR IN NOT BEING ABLE TO BENEFIT FROM SHARED LEARNING IN HONOR OF 01/18/12 SAVE THE INTERNET SOPA BLACKOUT.   HireLyrics Administrative Services U.S. Citizens Public Docket Federal Crime Victim Voters Edit Page  Page Properties index.html         HireLyrics Form of Employment Agreement Previews Jobs Creation 2012 Dept Justice Grant Proposals Edit Page  Page Properties roxannegrinageresume.html On     01/14/12 Alaska's OCS OPA Genocide by Kidnap Draws U.S. Citizens Public Docket Notice of Claim Edit Page  Page Properties alaskafamiliesnewcivilrightsheroes.html On     01/10/12 IVIEWIT INVESTIGATION - VOLVO NOTICE OF LIABILITY for CRIMINAL CIVIL COMPLAINTS Edit Page  Page Properties peoplesparty.html On     01/13/12 Social Worker Grandmother Motion Remind Washtenaw CWS Gov Granholm Signed Amer Bill Now Law Edit Page  Page Properties michiganfamiliesnewcivilrightsheroes.html On     01/12/12 Trackers See Dun & Bradstreet Investigate City Philadelphia DHS Steals HireLyrics D-U-N-S Edit Page  Page Properties lobbypic.html On     IRS SSI Fraud Notices Saundra Sullivan/Kearney/Tate/Autry Mechanic Erick Brown Child Abductions Edit Page  Page Properties hirelyricsfraudaudit.html On     010611 HireLyrics Dept Justice OIG Report Washington Cowlitz County RICO Public Safety Emergency Edit Page  Page Properties washingtonfamiliesnewcivilrightsheroes.html On     02/02/12 Florida DCF Corruption Whistleblower Randall Scott Kluge Life at Risk in Miami Lee County Edit Page  Page Properties floridafamiliesnewcivilrightsheroes.html On     Free Sign Up Join 112 Families and Growing Plan $1 Billion Lawsuit DHS Family Court Edit Page  Page Properties hirelyricscertifiedlegalnotices.html On     Maine Families Report DHS Employees Bully Local Police to Cause Child Rape Drug Injuries and Arrests Edit Page  Page Properties mainefamiliesnewcivilrightsheroes.html On     072711 Oregon American Family Rights Shares AFRA's Lawyer Friends Resource Help Washington Families Edit Page  Page Properties oregonfamiliesnewcivilrightsheroes.html On     082911 Father's Dept Justice Form 95 RICO Evidence Judge Dubow DHS Massey-Jackson Kidnap Schemes Edit Page  Page Properties dhshorrorstories.html On     Presidential Candidates Tasked Address Constituency Federal Crime Victim Voters Public Dockets Edit Page  Page Properties casestudies.html On     11/24/11 HireLyrics 1060 Federal Crime Victim Claimants Asks How Can We Fire Crooked Lawyers? Edit Page  Page Properties hirelyricsprototypeuscitizenspubliddocketdatabase.html On     112211 Illegal Adoption Victim Angela Barff-Eib U.S. Citizens Public Docket Evidence Reported Edit Page  Page Properties californiafamiliesnewcivilrightsheroes.html On     081111 Love Thomas Wright Cooper Exposed Parke County MT Federal Judge Jack D Shanstrom Corruption Edit Page  Page Properties lovecooperdocketbillingsmontanausdccorruption.html On     071711 Virginia, Richmond Candice Tyler Troy Davis Standard Claims Intake CPS Kidnap False Arrest Edit Page  Page Properties economycostsdocketdiscrimination.html On     080411 Champions of Patriotism Quotes Introduce Federal Crime Victim Voters Intervention Evidence Edit Page  Page Properties federalcrimevictimvoters.html On     11/24/11 Roxanne Grinage Focuses 2011 Tax Reporting on City of Philadelphia Officials Massive Fraud Edit Page  Page Properties classactionclaims.html On     10/20/11 A New Civil Rights Movement Sees New Civil Rights Heroes... Edit Page  Page Properties wadeleeauthorvsnutterambrosedhs.html On     071111 Restore Courage To Journalism Facts Remain Posted Truth for Sake of Truth In Public Record Edit Page  Page Properties malpracticecrimevictimvoters.html On     111311 HireLyrics Trackers See FBI USDOJ Search Philly Judges Dougherty Murphy Matthews Pechkurow Edit Page  Page Properties uscitizensdocketdataofficialcorruptionfraudcivilrights.html On     071411 Pennsylvania Philadelphia $1 Billion Class Action 112th Claims Intake 4 Generations Thomas Edit Page  Page Properties dhshearings.html On     070311 Pennsylvania, Philadelphia Massive Fraud DHS Retaliation Player Named by Bryan Jones Edit Page  Page Properties philadelphiacorruption.html On     071511 Growing Court Reform Interest in Minnesota Multiphasic Personality Inventory Test II (MMPI) Edit Page  Page Properties expertwitnesstestimony.html On     Buy HireLyrics Celebrate Twelve Step Recovery History Bronze Tokens & Executive Laser Engraved Pens Edit Page  Page Properties guardianangelatmyside.html On     Solutions for Child Slaughter U.S. Economy Fraud Court and Educaton Reform Public Safety Emergency Edit Page  Page Properties corruptioningovernment.html On     Roxanne Grinage v Fern Brown Caplan and Timothy E Possenti Esquire USDC PaED 209-cv-04119-MSG Edit Page  Page Properties 2_09_cv_04119_msg.html On     The evolution of prototype demonstration of an U.S. Economy Recovery Solutions Tool Edit Page  Page Properties claimsintake.html On HireLyrics Citizens Public Docket 1074 Federal Crime Victim Voters Support Save The Internet  http://youtube.com/HireLyrics http://youtu.be/rcWnNvXTWYI This is last part of Alexis Ohanian, reddit co-founde via video presentation just before all of Rebecca MacKinnon, Global Voices co-founder via video presentation.  Rebecca MacKinnon and Alexis Ohanian did answer questions and provide follow up in later parts of the Save The Internet Event which are uploaded in different video segments recorded by Roxanne Grinage’s camcorder.  http://hirelyrics.org http://facebook.com/roxanne.grinage http://twitter.com/HireLyrics http://youtube/hirelyrics http://youtube.com/whatistherelefttodo http://youtube.com/roxannegrinage http://blogtalkradio.com/born-to-serve Tel: (267) 444-0594 Fax: (215) 405-2939 Roxanne Grinage HireLyrics Administrative Services U.S. Citizens (controlled) Public Docket Database was able to RSVP attend and record on her flip phone camcorder another benefit of free and low cost internet technologies enabled standard access to shared learning for a now global community (HireLyrics Practice Model slogans) “Shared learning results in community courage and increased quality of life….HireLyrics shares our learning” and “Don’t lower any standard…Standardize the Access” and “Business Practices are evolving to accommodate Dignity For The Human Spirit” and “Support with all your might those teachers who cause the learning WE ARE MORE ALIKE THAN WE ARE DIFFERENT” and “Success is no longer a function of who you know or what you have” and “Survive and Hold On is a Business Rationale” and “Our Strength Is In our Ability to Collaborate” and “Galvanize Grassroots Voter Clout Education by Conversation” and in our 12th year the application of shared learning which creates tens of thousands of jobs in any combination of states Chapters and Department heads nonprofit Federal Dept of Justice or other Grant Funded “HireLyrics Jobs Creation 2012 Law Enforcement are Working Class People Too.” At 12/31/2011 Roxanne Grinage demonstrated U.S. Economy Education Military and Defense, Engineering, Medicine, Insurance, Healthcare, Court Reform, Family Preservation, Small Business Development, Entertainment Litigation and Public Safety enriching unlocked revenues previously locked in a limitless spanning every measureable demographic of Working Class Student Impoverished American family or business owner Roxanne Grinage recognizes at “Worldwide Population of Disadvantaged Creators”, amongst whom 1,074 claims intake assessment case studies using free and low cost internet technologies enable access to Legal Administrative Assistant and appropriate U.S. Courts and Department of Justice and Class Action Litigation Referrals of verified Federal Crime Victim created by Official Corruption Fraud Civil Rights crimes in accordance with U.S. Attorney General’s definition of same is.  HireLyrics Administrative Services has been demonstrating for almost twelve years that quality of life for working class student and impoverished Americans is raised when administrative solution tools are forged and implement that comply with existing laws while measuring individual accountability for work ethic synergy intent, negligence or willful criminal culpability.  “not the government – but individuals who abuse their official positioning to perpetrate felony crimes upon Americans in violation of Rights under color of law.”  This video description is a piece of an hour and a half of camcorder video Roxanne Grinage is uploading in segments of Roxanne Grinage recorded to share using the internet technologies with the tragically far too large Voter constituencies whose voter endorsement and impeachment clout can be organized and leveraged to achieve fair and holistic voting on legislation that impacts U.S. Economy Careers eCommerce Education and Public Safety and thereby American quality of life heritage, health, freedom, but without the holistic and uncensored access to internet collaboration will throw United States a former world power into the dark ages of despotism dooming any chance of environmental societal or family preservation. Progress Change Campaign Committee http://BoldProgressives.org (850,000 members strong) Today, Top tech innovators join progressive and conservative experts for a discussion about Internet censorship, online innovation, and the SOPA and PIPA bills. You can watch online and join in the conversation! ·                     Alexis Ohanian, reddit co-founder (via video) ·                     Craig Newmark, craigslist founder (via video) ·                     Rebecca MacKinnon, Global Voices co-founder ·                     Adam Green, Progressive Change Campaign Committee co-founder ·                     Julian Sanchez, Cato Institute fellow ·                     Brad Burnham, Managing Partner at Union Square Ventures ·                     Dmitry Shapiro, Veoh founder (via video) ·                     Jayme White, Staff Director, Senate Finance Subcommittee on International Trade

Posted 12/20/11 2:07 PM EST:  We have found out just now Lorraine Grinage's baby boy Grayson the little brother of 060810 Public Mob Assault led by Erick Brown and Saundra O. Sullivan/Kearney Family abducted children of Lorraine Grinage Ezekiel and Arriyel Brown is coming today, instead of waiting for scheduled c-section 12/22/11.  Roxanne Grinage thanks everyone immensely for the wonderful well wishes and prayers for protection.  We have done all we can to protect against the deliberate or records mis-management people eating machine of corrupt or incompetent City of Philadelphia DHS, Corrupt Philadelphia family court judges and paper pushing hospital social worker who don't take responsibility for the harm their oversights and civil rights violations cause families; seeking to cover up the crimes of their colleague Fern Brown Caplan, Esquire and Timothy E. Possenti Esquire more than 2 years ago August 14, 2009 which started our nightmare but also started a journey where we met the most amazing uplifting good people.  We have faith there are more good people than there are DHS Demonic Horror Stories.   We have attached to our Dept of Justice Form COL Violation Warning Denial Legal Notice and Warning Denial of Rights Under Color of Law 18 USC Section 242; 18 USC Section 245 42 USC Section 1983 Warning:  Notices of which Roxanne Grinage has several sets ready for hand out as needed or approached by a so called person who wants to "give us services" or take the baby out of the hospital with no accountability or based on the latest fraud statements of City of Philadelphia DHS Anne Marie Ambrose her cronies or Judge Robert J. Matthews and Margaret T. Murphy who issues orders based on hearings about people mental health without any such hearing ever occuring or Judge Kevin M. Dougherty who announces to a grandmother caregiver who lost her daughter and other children in Feltonville Crash, her remaining grandkids are "Well they are my kids now."  Very demonic DHS Demonic Horror Stories.  We have attached the criminal docket about the 06/08/10 Public Mob assault where erick and saundra came with 6 adult city of philadelphia employed and dhs foster contractor employed adult relatives with baseball bats and guns and beat merciless in front of trauma injured ezekiel and arriyel brown their pop pop who take care of their every need while their drug addict constantly relapsing father Erick Lee Brown was either on a drug run, running and hiding from drug dealers he owed money to or locked up.  Ezekiel and Arriyel also watched Saundra Sullivan attack their pregnant mommy with a bat all 45 min after being served with the Rule to show cause return Lorraine's children for recorded bragging about beating them 12/13/2009 while doing every other imagine fraud and theft crime including illegal car repairs, car theft, false report of stolen vehicle, insurance fraud, bigamy, false divorce affidavit in Georgia, etc.

1. Violation Warning Denial of Rights Under Color of Law Legal Notice and Warning Stay Away from Grinage Family Birth.

2.  Case Docket View CR-10-06-11-9549 Case Information Willie Brownson v Erick Brown 06/11/2010 Criminal Complaint, 0712/2010 Disposition - Refer to DA's Office. No Service.

3.  U.S. Department of Justice United States Marshals Services Plaintiff Lorraine Grinage v Saunra O. Sullivan Case 2:10 cv 00179-MSG Process Receipt and Return, 05/21/10 no contact; 06/05/03/10 Def no longer resides at this location.  And then Lorraine filed 06/18/11 Proofs photo of Erick Brown and Saundra Sullivan being served with Family Court Rule to Show cause in doorway with Ezekiel and Arriyel of 972 Anchor and pointed out for Federal Judge Goldberg they had lied to U.S. Marshals when they said they did not live there, so Honorable Mitchell Goldberg ordered the Marshals to return and attempt service U.S. Marshal Affidavit returned 07/01/10 Mailman states all occupants moved "weeks ago." Visual observation through window shows residence is vacant. Summons Returned Unexecuted.

4. Pennsylvania Child Abuse History Clearance LORRAINE C. GRINAGE VERIFICATION DATE:  08/01/2011, PO Box 22225, Philadelphia Pa 19136 and

5. Pennsylvania Child Abuse History Clearance ROXANNE GRINAGE VERIFICATION DATE:  08/01/2011, PO Box 22225, Philadelphia Pa 19136 and

6. Anticipating the registered common fraud modus operandi of financially incented social workers who falsify case reports and lie about newborns having been born with drugs in their system so social services can abuse cps federal funding sources to illegal transport by kidnpa for profit of newborns from the hospital to one of the hundreds of contractors like Children's Choice Inc where infants are summarily abused neglected and witnessed in deplorable conditions, we have had an independent drug screen done so that not even a hospital social worker where Lorraine received prenatal care can lie or the fate of Grinage Family rests upon the integrity or lack thereof of any social worker or state employee.

 DEPT OF JUSTICE FORM COL LEGAL NOTICE AND WARNING VIOLATION DENIAL OF RIGHTS UNDER COLOR OF LAW.

Federal law provides that it is a crime to violate the Constitutional Rights of a citizen under the Color of Law. You
can be arrested for this crime and you can also be held personally liable for civil damages.
Attempting to coerce or deceive a citizen to surrender his Constitutional Rights is a Federal Crime. Federal Courts have
found that your ignorance of the law is no excuse.
18 USC §242 provides that whoever, under color of any law, statute, ordinance, regulation, or custom, willfully subjects any
person in any State, Territory, Commonwealth, Possession, or District to the deprivation of any rights, privileges, or
immunities secured or protected by the Constitution or laws of the United States ... shall be fined under this title or
imprisoned not more than one year, or both, and if death results, or if such acts include kidnapping or an attempt to kidnap,
aggravated sexual abuse or an attempt to commit aggravated sexual abuse, or an attempt to kill, shall be fined under this
title, or imprisoned for any term of years or for life, or both, or may be sentenced to death.
18 USC §245 provided that Whoever, whether or not acting under color of law, intimidates or interferes with any person from
participating in or enjoying any benefit, service, privilege, program, facility, or activity provided or administered by the United
States; [or] applying for or enjoying employment, or any perquisite thereof, by any agency of the United States; shall be fined
under this title, or imprisoned not more than one year, or both, and if death results or if such acts include kidnapping or an
attempt to kidnap, aggravated sexual abuse or an attempt to commit aggravated sexual abuse, or an attempt to kill, shall be
subject to imprisonment for any term of years or for life or may be sentenced to death.
42 USC §1983 provides that every person who, under color of any statute, ordinance, regulation, custom, or usage, of any
State or Territory or the District of Columbia, subjects, or causes to be subjected, any citizen of the United States or other
person within the jurisdiction thereof to the deprivation of any rights, privileges, or immunities secured by the Constitution
and laws, shall be liable to the party injured in an action at law, suit in equity, or other proper proceeding for redress.
Warning, you may be in violation of Federal Law and persisting with your demand may lead to your arrest and/or civil
damages. Also understand that the law provides that you can be held personally responsible and liable, as well as your
company or agency.
You are advised to cease and desist with your demand and to seek personal legal counsel if you do not understand the law.
Notice of Service:
I, _________________________________________certify that I personally delivered this notice to above named recipient
and address on ________________________________at ____________(am/pm).
Public Domain—Privacy Form COL(02)
This document was created with Win2PDF available at http://www.win2pdf.com.
The unregistered version of Win2PDF is for evaluation or non-commercial use only.
This page will not be added after purchasing Win2PDF.

Roxanne Grinage PO Box 22225 Philadelphia Pa 19136 Direct Dial Cell (267) 444-0594 Fax: (215) 405-2939 roxannegrinage@yahoo.com www.HireLyrics.org www.Facebook.com/Roxanne.Grinage www.Twitter.com/HireLyrics www.YouTube.com/HireLyrics www.Youtube.com/WhatIsThereLeftToDo www.YouTube.com/RoxanneGrinage www.BlogTalkRadio.com/Born-To-Serve Roxanne Grinage Resume Baby Shower Grandchildren Stop Free Work at 1060th Federal Crime Victim Claimant Verified.

U.S. Citizens Controlled Docket Litigation Referrr

How Financially Devastated CPS DHS Victims Can Get Standard Access to Litigation Referral

HireLyrics 1074 Citizens Docket Federal Crime Victim Voters Join Save Internet SOPA Blackout	When Blackballed Because You Did The Right Thing...Create Create Solutions!	Jobs Creation Corruption Clean Up Nonprofit Knows Law Enforcement Are Working Class People Too	IRS Tax Reporting for Family Court DHS CPS CPA Lawyer Malpractice Federal Crime Victims
HireLyrics Litigation Referral Expands to All Neighbors Welcome Jobs Creation Nonprofit	Roxanne Grinage Administrative Solutions for U.S. Econony Court and Education Reform	Poor Families Hone Pro Se Whistleblower Forms Move Closer Federal Indictments Corrupt CPS DHHS DHS ACS OCS DCF	Campaign Agendas Lawmaker Reform Special Prosecutors See Pro Se Federal Crime Victim Voters

IRS Tax Reporting for Family Court DHS CPS CPA Lawyer Malpractice Federal Crime Victims	Jobs Creation Corruption Clean Up Nonprofit Knows Law Enforcement Are Working Class People Too	Roxanne Grinage's Dept of Justice Grant Proposal Is Aug 2 2011 Open Letter President Obama	HireLyrics Litigation Referral Expands to All Neighbors Welcome Jobs Creation Nonprofit

IRS Tax Reporting for Family Court DHS CPS CPA Lawyer Malpractice Federal Crime Victims	Jobs Creation Corruption Clean Up Nonprofit Knows Law Enforcement Are Working Class People Too	Roxanne Grinage's Dept of Justice Grant Proposal Is Aug 2 2011 Open Letter President Obama	Tax Report Philly "Mechanic Eric & Son" Mob Assault Child Abductions SSI Fraud Identity Theft

Print - Close Window Subject: Please investigate whether City of Philadelphia DHS has performed fraudulent billing on HireLyrics D-U-N-S discovered stolen today while beginning OJP grant application. From: Roxanne Grinage (roxannegrinage@yahoo.com) To: oig.hotline@usdoj.gov; yelenh@dnb.com; edurham@ftc.gov; nsamter@ftc.gov; dhorn@ftc.gov; cschrode@pahousegop.com; jyudichak@pahouse.net; mvereb@pahousegop.com; Date: Tuesday, January 10, 2012 1:44 PM Roxanne Grinage, Owner, Legal Administrative Assistant Project Manager HireLyrics Administrative Services U.S. Citizens Public Docket Database PO Box 22225 Philadelphia Pa 1916 Tel.  267-444-0594             Fax. 215-405-2939 www.HireLyrics.org          www.Twitter.com/HireLyrics         www.Facebook.com/Roxanne.Grinage www.BlogTalkRadio.com/Born-To-Serve    www.YouTube.com/HireLyrics www.YouTube.com/WhatIsThereLeftToDo                www.YouTube.com/RoxanneGrinage   Respectfully addressed the urgent attention of: E-mail: AskOJP Laurie O. Robinson Assistant Attorney General Office of Justice Programs U.S. Department of Justice Bureau of Justice Assistance Office of Justice Programs 810 Seventh Street NW Washington, DC 20531 Fax: 202-305-1367 Phone: 202–307–0703 Web site: www.ojp.gov   Re: 2010 OJP Program Plan   Section 5 - Effective Interventions To Address Violence, Victimization, and Victims’ Rights   Section 6 - Enhancing Law Enforcement Initiatives Overview   Section 7 - Supporting Innovation in Adjudication E-mail: oig.hotline@usdoj.gov U.S. Department of Justice Office of the Inspector General Investigations Division 950 Pennsylvania Avenue, N.W. Room 4706 Washington, DC 20530 Hotline: (800) 869-4499 or Hotline Fax: (202) 616-9881   Email: Governmental Affairs: Harvey Yelen - yelenh@dnb.com  The D&B Corporation Corporate Headquarters Attn: D-U-N-S Fraud Investigations 103 JFK Parkway Short Hills, NJ 07078 www.dnb.com Tel. 973.921.5500   Email: edurham@ftc.gov,  nsamter@ftc.gov   dhorn@ftc.gov    Willard K. Tom, General Counsel Federal Trade Commission Attn: Investigate City of Philadelphia DHS Fraud Billing Federal Grant Sources Stolen Small Business Owners’ D-U-N-S 600 Pennsylvania Avenue, NW H-570, 0721, H-568 Washington, DC 20580 Direct Dial:   (202) 326-2222 www.ftc.gov   Pennsylvania Lawmakers who proposed Bipartisan Public Integrity Commission (cschrode@pahousegop.com) (edepasquale@pahouse.net) (jyudichak@pahouse.net) (mvereb@pahousegop.com)   City Philadelphia DHS Caught Stolen Dun & Bradstreet No. HireLyrics Alerts Law Enforcement   City of Philadelphia DHS 1515 Arch St Hijacks HireLyrics Dun & Bradstreet Number.   U.S. Dept of Justice, Dun and Bradstreet and Office of Inspector General, Office of Inspector General and U.S. Attorney Eric Holder notified that City of Philadelphia DHS Legal Department deliberately created a fraudulent D-U-N-S number for HireLyrics Administrative Services associated with City of Philadelphia DHS Legal Department address and likely abused to fraudulently bill federal grant sources.   These are the HireLyrics Jobs Creation community development services for which Roxanne Grinage was attempting to apply for Department of Justice Office of Justice Programs Office of Crime Victims only available grant source for individual/sole proprietorships, deadline February 14, 2012 which now having discovered City of Philadelphia DHS has fraudulently registered 1515 Arch Street, 16th Floor, Philadelphia Pa as the physical address of HireLyrics no doubt there will be costly and time consuming investigations to examine whether City of Philadelphia DHS has likely billed a Federal Grant Source having stolen at least one business owner’s identity by defrauding Dun and Bradstreet secure financial data management services.  Oh well, I guess another Federal Lawsuit?  How does one measure damages caused by loss of three years funding that would have restored public safety slowed a child slaughter, enriched U.S. economy careers contribution and galvanized grassroots community voter clout?    Early this morning, Tuesday, January 10, 2012, while starting the necessary steps for applying for Dept of Justice Office of Victims of Crime grant application so that HireLyrics can subsidize or provide free claims forms and pro se federal lawsuit document production services while organizing the voter clout of a tragically far too large financially devastated population of Federal Crime Victims created by Official Corruption Fraud Civil Rights crimes ─ Roxanne Grinage, Legal Administrative Assistant Project Manager and almost twelve years owner of Secretary of State Pennsylvania and U.S. Department of Treasury registered sole proprietorships HireLyrics Administrative Services and U.S. Citizens Public Docket Database discovered, when going to update the physical location of HireLyrics Administrative Services D-U-N-S number a number assigned by Dun & Bradstreet secure financial data management services….    Roxanne Grinage was absolutely “floored” to discover HireLyrics Administrative Service D-U-N-S had been hijacked/stolen by City of Philadelphia DHS Legal Department 1515 Arch Street, 16th Fl, Philadelphia Pa 19107.  Not replaced – another D-U-N-S number registered by City of Philadelphia DHS Legal Department after HireLyrics authentic original D-U-N-S number in 2001.   No way could the hijacking of a D-U-N-S number be a result of City of Philadelphia DHS notorious incompetent records-mismanagement.  Not a mistake – Deliberate Theft with the intent of Fraudulent Billing of Federal Funding Sources.  City of Philadelphia DHS’ legal department theft of HireLyrics Administrative Services Dun & Bradstreet Number is no accident.  This is another deliberate felony crime “Identity Theft / Fraud” perpetrated by a bunch of serial criminals who are used to getting away with felony crimes against working class student and impoverished families and business owners under color of law.   What in the world is City of Philadelphia DHS’ problem?  Is City of Philadelphia DHS so plagued with DHS Demonic Horror Stories that they just can’t help but run around stealing every person place and thing they can?    You can bet a dime to a donut that feigned scatter brained Anne Marie Ambrose and her partners in crime City Solicitors Craig T. Straw and Barbara A. Ash know that City of Philadelphia DHS lied to Dun & Bradstreet secure financial data management services in order to steal HireLyrics Administrative Services D-U-N-S physical location inserted as DHS’ physical location (1515 Arch Street, 16th Floor, Philadelphia Pa)  because having the D-U-N-S number is the beginning of billing Federal and State funding sources after all; necessary for the continuance of City of Philadelphia and Philadelphia Family Court Judges “no holds barred big as day” “In your face” Irreverent “what are you going to do about it” RICO Indictable Public Safety Emergency posed by Fraud Schemes.    As of January 01, 2012 Roxanne Grinage has verified by standard access to legal administrative assistant claims intake assessment 1,074 (growing daily by standard access to presentation of claims regardless of who you know or what you have) Federal Crime Victims created by Official Corruption Fraud Civil Rights crimes, 112 plaintiffs and growing plan to sue City of Philadelphia Department of Human Services (DHS Demonic Horror Stories) and First Judicial District Court of Common Pleas Family Division Judges for their Official Corruption Fraud Civil Rights crimes which have inflicted personal injuries irreparable harms upon the working class student and impoverished families and business owners of Philadelphia, Pennsylvania while defrauding U.S. Economy enriching careers contributions and just about every federal and taxpayer funding source auditors care to examine.   Anne Marie Ambrose Commissioner of DHS will no doubt claim she is unaware as she always does having been quoted in Daily News answering queries about kidnap for profit schemes, “It’s all so complicated”.  When approached during families protest of DHS illegal adoptions on the steps of 1515 Arch Street by grandmother Feltonville Crash and Third Street Angels twice victimized by DHS Demonic Horror Stories Judge Kevin M. Dougherty declaring in open court regarding the surviving grandchildren of Janice Brown West and Maurice West, “Well, They are My Kids Now”; Anne Marie Ambrose, told Janice Brown West, “I’m sorry for what happened” after Janice Brown West’s grand children were witnessed by community not recognizing their family, coming and going to school dressed in ragged clothing, personal grooming neglected and ever popular with all DHS foster placements glazed eyes slowed reflexes headaches and nausea of psychotropic forced chemical medical error accompanied by letters from DHS doctor contractors  to confirm separation trauma injuries and of course the need for psychotropic chemicals to treat the DHS Judge Kevin M. Dougherty “They are my kids now” inflicted injuries.    For once I would like scatter brained Anne Marie Ambrose and yet to be accountable for anything but receiving pompous un-deserved awards and recognitions from billing contractor providers, Judge Kevin M. Dougherty to apologize after disclosing who got paid how many times for the illegal transport and illegal reassignment of persons property and heritage that Judge Kevin M. Dougherty and Anne Marie Ambrose so flagrantly claim they have jurisdiction over but nothing to say when evidence responsibly reported respectfully posted to U.S. Citizens (controlled) Public Docket Database reveals serial criminal RICO Indictable crimes calling for U.S. Department of Justice Federal Law Enforcement and States Lawmakers appointed Special Prosecutors to Prosecute Gangsters who have infiltrated the institutions and processes rightfully intended for the preservation of society and family and U.S. economy enriching careers.   DHS Commissioner, Anne Marie Ambrose, 1515 Arch Street, 8th Floor, Philadelphia Pa 19107 is an official corruption fraud civil rights defendant sued in her individual criminal capacity along with Judge Robert J. Matthews $6.2 Million Theft of Vested Interest Career Theft in a Federal Lawsuit U.S.D.C. 209-cv-5448-BMS.    The Theft of Vested Interest Federal Lawsuit was brought by Plaintiffs Willie Brownson Ezekiel Zadkiel Brown and Arriyel Roxanne Brown who sued Anne Marie Ambrose and Judge Robert J. Matthews for overwhelming evidence of cumulated forty-seven official corruption fraud civil rights crimes which included conspiracy kidnap for profit through falsification of records, perjury and colleague protection of Fern Brown Caplan, Esquire (famous attorney Gloria Allred’s stated in 48 hours interview best friend) and Timothy E. Possenti, Esquire which destroyed the Pennsylvania Minority Women Business Enterprise Certified business (HireLyrics, Versatileasy Recovery Print and Birth Wright Doll Collection Mother Daughter Tea Tour) owned by Plaintiffs’ provider and employer wife and grandmother Roxanne Grinage documented in another Federal Lawsuit Roxanne Grinage v. Fern Brown Caplan, Esquire et al U.S.D.C. 209-cv-04119-MSG.    Anne Marie Ambrose and Judge Robert J. Matthews were exposed lying to U.S. Department of Justice, Federal Judges Mitchell S. Goldberg and Burle M. Schiller, Lying to U.S. Marshals and Lying to Corrections Officers at CFCF jail; DHS case worker Kenneth A. Dixon lying about home investigations; Family Court Supervisor Judge Margaret T. Murphy lying about hearings on mental health that never occurred.    Anne Marie Ambrose ignored multiple emails and calls to DHS child abuse Hotline (recorded) and obstructed help to two babies being recorded and bragged about beat by two drug addict alcoholic child abusers Erick Brown and Saundra O Sullivan on December 13, 2009 which eventually caused the 06/08/10 public mob assault child abductions of now parent alienation trauma injured irreparably harmed Ezekiel and Arriyel Brown, Lorraine Grinage’s children, documented in Federal Lawsuit, Lorraine Grinage v Saundra O. Sullivan Erick Brown Diane and Lenwood Kearney, U.S.D.C. 210-cv-00179-MSG.  See June 18, 2010 filing. https://docs.google.com/viewer?a=v&pid=explorer&chrome=true&srcid=0BwkY4FQWX-6pMTliNWMzZDYtYjM5YS00NWFjLWFkMDAtOTAwODcxODhhNGI2&hl=en_US also enclosed after signature.   “HireLyrics™ JOBS CREATION 2012 Law Enforcement Are Working Class People Too!”© FEDERAL CRIME VICTIM VOTERS Created By Official Corruption Fraud Civil Rights Crime American Working Class Students Impoverished Families & Business Owners   HireLyrics™ Scope of Services OPTION 1: PRO SE DOCUMENT PRODUCTION These standard services are a preview of Jobs Creation 2012 HireLyrics is in the process of applying for grant funding for so that financially devastated American Federal Crime Victims verified by standard access to claims intake assessment and litigation referral may receive Pro Se Document Production and Claims Forms Preparation free or at substantially subsidized cost while community enrichment jobs are created. HireLyrics Claims Intake Assessment Performed by a Legal Administrative Assistant:  Evidence Gathering Depositions and Expert Witness Testimony HireLyrics Litigation Referral:  Merits of Claim Contingent Liabilities Assessed; verified evidence indicated Calls for Class Action, Special Prosecutor or Defense, Private  Investigator, Forensics, Credentialed Expert Witnesses or other Legal Industry Support Service including transcriptionists researchers paralegals, technology, law or business school students. Legal Administrative Assistant Verification Report:  Docket Analysis; Identify Conflict of Interest; Measure Individual Accountability Components:  Work Ethic, Compliance, Negligence, Records Mismanagement, Employee Misconduct, Malpractice; Embezzlement or Fraudulent Billing; discern whether bogus warrants, whistleblower retaliation, false arrest, nepotism or judicial tyranny.  Package and submit due diligence as trial prep evidence modules which responsibly record respectfully report degrees of individual accountability for Official Corruption Fraud Civil Rights crimes perpetrated under color of law against American working class student impoverished families and business owners. HireLyrics Trial Prep Evidence Binder:  Legal Administrative Assistant Summarized Marked Exhibits Index provided to HireLyrics Client on Data Disc or Flash Drive and, if authorized by Federal Crime Victim Pro Se Claimant, active links posted to HireLyrics Administrative Services managed case study page prototype demonstration of U.S. Citizens Public Docket Database on the internet at www.HireLyrics.org. U.S.D.C. Pro Se Forms Compliant Federal Civil Lawsuit Complaint HireLyrics Legal Administrative Assistant Drafts Affidavit of Facts compiled from evidence provided by Federal Crime Victim Claimant; prepares U.S. District Court official package of pro se Federal Lawsuit Complaint form, and if asked by HireLyrics Client, gathers the information necessary and completes U.S.D.C. pro se forms package compliant Petition Informa Pauperis (Poverty Affidavit; Indigent Litigant) asking U.S. District Court for permission to waive Filing Fee.  The Pro Se Claimant (HireLyrics Client) must sign and file with the Court by Certified Mail or Hand Delivery on their own behalf.  HireLyrics Legal Administrative Assistants are not attorneys are not enrolled to practice before the IRS and do not represent any person in any court or claims process. If verified evidence indicates:  HireLyrics Certified Service Distribution Fraud Report Whistleblower Transmittal Law Enforcement Investigation and Audit Request                                                                                      Presidential Executive Officers, U.S. Department of Justice, Appropriate U.S. Senate Committees, U.S. Courts Administration; State Lawmakers, Child Abuse Registry, Child Support Enforcement, Licensing and Disciplinary Review Boards, Internal Revenue Service Office of Professional Responsibility (IRS OPR); U.S. government Accountability Office (GAO) and others as verified evidence indicates and lawful reporting opportunities become available. If verified evidence indicates: Appropriate Referrals to U.S. Department of Justice Programs (OJP Victims of Crime):  Domestic Violence Elderly Abuse and Mistreatment Identity Theft or Theft by Deception Schemes. In an effort to send a clear message that HireLyrics will not allow the quality of life enhancing results of a standard access mechanism to be hindered by misuse, HireLyrics will promptly report all facts and evidence discerned during claims intake assessment; due diligence, trial prep, research and discovery including those challenges and crimes for which there is help or criminal justice intervention by way of appropriate referral. Example:  If a Federal Crime Victim’s claims of official corruption are verified and the claimant is observed to need help with addiction, vocational rehab, arrest recidivism intervention or penal action is necessary to intervene in a discovered domestic violence or elder abuse, identity theft or scams of defenseless Americans; HireLyrics will move swiftly decisively lawfully and without notice to cause appropriate reports referrals and notices to appropriate law enforcement and funded neighborhood innovation programs. If verified evidence indicates:          HireLyrics Certified Service Notice to Federal State County Employers. HireLyrics Certified Service Notice to Federal State County Employers of evidence verified Employee(s) or Professional Practitioner Misconduct, Bribery, Coercion, Intimidation, Extortion, Nepotism, Cover Up Censorship Rerouting Destruction of Evidence, court filings, Falsification of Records Fraud Embezzlement Kidnap For Profit. If verified evidence indicates: U.S. Department of Justice Form 95 Claim For Damages or Wrongful Death Caused by a Federal Agency. If verified evidence indicates: U.S. Department of Justice Office of Inspector General (OIG) Fraud Waste Abuse Misconduct Report. If verified evidence indicates:                                            Certified Service Form COL Violation Warning Denial of Rights Under Color of Law Violation Warning—18 U.S.C. §242; 18 U.S.C. §245; 42 U.S.C. §1983. “I certify that the forgoing information stated here is true and correct.  Legal Notice and Warning - Federal law provides that it is a crime to violate the Rights of a citizen under the color-of-law. You can be arrested for this crime and you can also be held personally liable for civil damages.” Certified Service Distribution of Form COL Violation Warning Denial of Rights Under Color of Law Violation Warning—18 U.S.C. §242; 18 U.S.C. §245; 42 U.S.C. §1983 is always publicly posted to HireLyrics Administrative Services managed case study pages within prototype demonstration of U.S. Citizens (controlled) Public Docket Database. If verified evidence indicates: Dept of Justice Executive Office For Immigration Review Alien’s Change of Address Form Board of Immigration Appeals If verified evidence indicates: Dept of Justice Executive Office For Immigration Review Immigration Practitioner Complaint If verified evidence indicates: Dept of Justice Executive Office For Immigration Review Application for Cancellation of Removal and Adjustment of Status for Certain Nonpermanent Residents A management team of Federal Crime Victim Voters created by State Court Conflict of Interest with DHS malpractice will organize the endorsement and impeachment clout of a tragically far too large voter constituency while we create jobs in our community that recognize “Law Enforcement are Working Class People Too!” and restore and protect public safety, educate, make referrals to ethical litigators and claims processes; transmit Fraud Reports and Recovery Act Fraud and Waste Whistleblower transmittals; honor our Commonwealth, States’ and U.S. Constitutions; and provide constitutionally correct People’s Protection Safe Haven for DHS and Court Ordered Abused Runaways.  The Federal Crime Victim Voter Statement:  If one of us should fall…or ten of us should fall…or a hundred of us should fall…WE WILL HAVE A COMMUNITY-NEEDS POWERED personality independent MECHANISM in place which will AUTOMATICALLY TRIGGER the rescue of kidnap for profit injured working class student and impoverished American children of all ages.”  Respectfully Roxanne Grinage Notations and Enclosures itemized below. About the D-U-N-S Number http://fedgov.dnb.com/webform/displayFAQPage.do http://fedgov.dnb.com/webform/pages/dunsnumber.jsp  Created in 1962, the Data Universal Numbering System or D-U-N-S® Number is D&B's copyrighted, proprietary means of identifying business entities on a location-specific basis. Assigned and maintained solely by D&B, this unique nine-digit identification number has been assigned to over 100 million businesses worldwide. A D-U-N-S® Number remains with the company location to which it has been assigned even if it closes or goes out-of-business.  The D-U-N-S® Number also "unlocks" a wealth of value-added data associated with that entity, including the business name, physical and mailing addresses, tradestyles ("doing business as"), principal names, financial, payment experiences, industry classifications (SICs and NAICS), socio-economic status, government data and more. The D-U-N-S® Number also links members of corporate family trees worldwide.  The D-U-N-S® Number is widely used by both commercial and federal entities and was adopted as the standard business identifier for federal electronic commerce in October 1994.  The D-U-N-S Number® was also incorporated into the Federal Acquisition Regulation (FAR) in April 1998 as the Federal Government's contractor identification code for all procurement-related activities.  http://fedgov.dnb.com/webform/displayFAQPage.do Frequently Asked Questions for D-U-N-S Number and CCR Registration DMCA Copyrights owned and rigorously counterclaimed by Roxanne Grinage willing to accept service in U.S.D.C. for the Eastern District of Pennsylvania Service Address:  Roxanne Grinage HireLyrics Administrative Services, U.S. Citizens Public Docket Database, PO Box 22225, Philadelphia Pa 19136, Telephone 267-444-0594, Fax 215-405-2939 email for electronic service dignityforthehumanspirit@hirelyrics.org website www.HireLyrics.org Forever referred to by historians as Champions of Patriotism Quotes Roxanne Grinage August 02, 2011 Letter to President Barack Obama, U.S. Attorney Eric Holder, Office of Civil Rights Regions Enclose HireLyrics Administrative Services Evidence RICO and Title 18 Indictable Judges Social Workers, Lawyers, Psychological Evaluators and Elected Officials Indicated Need For Presidential and Justice Department Intervention to Protect National Security Public Safety Emergency Posed by a Nationwide Child Slaughter U.S. Economy Fraud Court and Education Public Safety State of Emergency. responsibly recorded respectfully reported, Roxanne Grinage, Legal Administrative Assistant HireLyrics Administrative Services U.S. Citizens (controlled) Public Docket Database Grinage Family Private Investigation Rescue 060810 Abusive Parent Mob Assault Abducted Ezekiel and Arriyel Brown, PO Box 22225 Philadelphia Pa 19136, www.HireLyrics.org www.BlogTalkRadio.com/Born-To-Serve, 267-444-0594, Fax: (215) 405-2939 RoxanneGrinage@Yahoo.com or DignityForTheHumanSpirit@HireLyrics.org https://docs.google.com/viewer?a=v&pid=explorer&chrome=true&srcid=0B_UmvYpq4WCUNWE2NGEwN2UtNjUwZi00YTBjLWFkYmItNjJkNjY3NmU0YTAy&hl=en_US Free Download Re-posted 10/20/11 Build This! Roxanne Grinage 11 years Prototype Demonstrated Standard Access Practice Model Schematics Reported at Fifth Anniversary 2005 birthed Administrative Solutions Tool U.S. Citizens controlled Public Docket Database Corruption in Government Clean Up Child Slaughter U.S. Economy Fraud Court Education Reform Public Safety Emergency.pdf https://docs.google.com/viewer?a=v&pid=explorer&chrome=true&srcid=0B-34Z89xij26NGZhYzc5NTMtYWEwMi00Y2MyLWE2OTYtYTdiODI5OWRmODFl&hl=en See Roxanne Grinage's Memorial Day Letter on behalf of Ezekiel and Arriyel Brown and thirty-two City of Philadelphia DHS and Family Court corruption Federal Crime Victim Witness families, to Mr. Eric Holder U.S. Department of Justice (8 pages with active links) INTERVENTION REQUEST USDOJ APPOINT SPECIAL PROSECUTOR(S) Child Slaughter U.S. Economy Fraud Court Reform State of Emergency Systematic Abuse of Immunity Language in 1983 Civil Rights Act. Pennsylvania Eastern District, Philadelphia County All Philadelphia Family Court and DHS Adjudications Are Not In The Best Interest of Working Class Student and Impoverished Families and Children A New Civil Rights Movement Is Underway CPS Corruption in Government Clean Up Initiative Families Fight Back say "NO MORE" DHS Demonic Horror Stories. Respectfully submitted by Roxanne Grinage on behalf of evidence data gathered from thirty-two (32) Federal Crime Victim Witness Plaintiffs Families. https://docs.google.com/viewer?a=v&pid=explorer&chrome=true&srcid=0BwkY4FQWX-6pYWQzOTJhYmEtOWQzMS00YzYyLTk2ZGItNGRmY2Y2Mjg0MmFh&hl=en_US 053111 Special Prosecutor Intervention Audit Review Requested 070610 Filing Figure 1 Docket Discrimination Analysis U.S.D.C. Paed 209cv04119MSG Roxanne Grinage v Fern Brown Caplan Esquire et al.doc (289 KB) 7:21 am by HireLyrics Download https://docs.google.com/leaf?id=0BxAauJ_oh-KFOWI2NTAzNmYtYTMwZS00OThkLTgyMTctMjE2ZmJhZWY2MTlj&hl=en_US 021311 IRS PACSES USM285 USDOA USDC Notices Grinage Family Rescue Ezekiel Arriyel Brown Philadelphia Family Court DHS Malpractice Judge Robert Matthews Kevin Dougherty Anne Ambrose Erick Brown 060810 Mob Assault Abduction Fraud.pdf  https://docs.google.com/viewer?a=v&pid=explorer&chrome=true&srcid=0B_UmvYpq4WCUODdkMzVlYmMtZTIyYS00MGZjLTk3NjMtZTMzMDc4ZjEwYjFl&hl=en 012311 Confidential Distribution List Redacted Roxanne Grinage HireLyrics Checklist Proposal Management Team Invitations First Draft Business Plan Nonprofit Federal Crime Victim Voters Safe Haven DHS Abused Runaways.pdf https://docs.google.com/open?id=0B-34Z89xij26MTkxMTIyYzMtMTViOS00MjczLTk5MGEtZWNmNzk0MzgxZWY3 052711 SCHEDULE C U.S. Citizens controlled Public Docket Citizens Video Journalism Public Post Incident Reports HireLyrics Administrative Services Roxanne Grinage Family Rescue Ezekiel Arriyel Brown.doc (2 MB) 4:53 pm by HireLyrics.org Download https://docs.google.com/open?id=0B-34Z89xij26OWQxNDAyYjMtOWMwNC00ZWYxLTlmNTYtZmFjMzdiYjYzN2Mx Print fill in and fax back the second page of this pdf file if you want us to contact you to verify your claim to join class action lawsuit 70 families and growing plan to sue City of Philadelphia DHS and certain Philadelphia Family Court Judges with Certain Named City Solicitors Child Advocates Commissioner Case Workers. See Roxanne Grinage HireLyrics Mar 15 2011 Metro Philly Ad. Fax completed form back to 215-405-2939. Join 70 Families Plan $1 Billion Lawsuit No 2nd Term Nutter DHS Family Courtroom Killing Floors Must Close.pdf  https://docs.google.com/viewer?a=v&pid=explorer&chrome=true&srcid=0B-34Z89xij26YWE2ZDY5ZjctNTc4YS00ZGU1LTgzMWEtZDMzNzM3MGQwY2Qy&hl=en http://ireport.cnn.com/docs/DOC-564973 See Full Length 33min video what happened 02/28/2011 when New Civil Rights Movement New Civil Rights Heroes Families Fight Back Say No More DHS Demonic Horror Stories, Janice Brown, Maurice West, Roxanne Grinage reviewed the records ordered produced by Subpoena upon DHS City of Philadelphia Deputy Solicitor Barbara A. Ash – an historic event in turning the tide for a so far unaccountable Philadelphia Family Court with DHS agency daily kidnap for profit child slaughter, theft of heritage, religious freedoms, forced commerce, siphoned embezzled federal and state funds by deliberate or  incompetent falsification of records and lying in official court documents:  Child Abuse Registry Fraud; Child Support Enforcement Fraud; Mental Health Exam Fraud; unlawful attachments, double and triple billing, etc. at CNN iReport HireLyrics Roxanne Grinage http://ireport.cnn.com/docs/DOC-564973 6/18/2010. U.S.D.C. PaED 2:10cv00179-MSG COS Copy Filed Today: PLAINTIFF LORRAINE GRINAGES COMPLIANCE WITH HONORABLE MITCHELL S. GOLDBERGS ORDER OF MAY 10, 2010 SUBMITS PHOTO VIDEO AND WITNESS EVIDENCE DEFENDANT SAUNDRA O. SULLIVAN HAS LIED TO U.S. MARSHAL TO EVADE SERVICE OF SUMMONS AND RESIDES AT 972 ANCHOR STREET, PHILADELPHIA, PA 19124 WHERE SHE WAS PRESENT ON JUNE 8, 2010 AT 6:30 P.M. 45 MINUTES BEFORE SAUNDRA O. SULLIVAN PARTICIPATED IN SIX MEMBER FLASH MOB WITH GUNS AND BASEBALL BATS ATTEMPTED HOME INVASION AND INFLICTED AGGRAVATED ASSAULTS OF LORRAINE GRINAGE, ROXANNE GRINAGE AND WILLIE BROWNSON ENDANGERING LORRAINE GRINAGES CHILDREN TRANSPORTED AND LEFT UNATTENDED IN SAUNDRA SULLIVANS WHITE BRONCO IN THE MIDDLE OF FLASH MOB VIOLENCE. Friday, June 18, 2010 8:04 PM From: "Roxanne Grinage" <roxannegrinage@yahoo.com> To: MarvinWilliams@pacses.com,kevin.dougherty@courts.phila.gov, "President Judge Dembe CCP Philadelphia" <hr@courts.phila.gov>, "President Judge Marsha Neifield" <Marsha.Neifield@courts.phila.gov>, "Court of Judicial Discipline Harrisburg Pennsylvania" <Wanda.sweigart@pacourts.us>, "Philadelphia District Attorney" <DA.WebMail@phila.gov>, "Child Abuse Registry Director Harriet Dichter" <HDichter@state.pa.us>, "Mayor Nutter Address 1" <Michael.Nutter@phila.gov>, "Mayor Nutter Address 2" <Mayor.Nutter@phila.gov>, governor@state.pa.us, John.D.Christmas@phila.gov, "Anne Ambrose DHS" <AnneMarie.Ambrose@phila.gov>, "Supreme Court Rules Evidence Committee" <appellaterules@pacourts.us> Cc: "Daily News Reporter Janice Brown DHS Story" <farrs@phillynews.com>, "Daily News Reporter Sparkle Ballard DHS Story" <difilid@phillynews.com>, 2020@abc.com, 48hours@cbsnews.com, 60m@cbsnews.com, "USDOJ Michael Levy Philadelphia" <AskDOJ@usdoj.gov>, fair@fair.org, "FBI Philadelphia Complaints" <Philadelphia.complaints@ic.fbi.gov>, foxreport@foxnews.com, Hannity@foxnews.com, hardball@msnbc.com June 18, 2010 HAND DELIVERED Michael E. Kunz, Clerk of Court United States District Court for the Eastern District of Pennsylvania 601 Market Street, Room 2609 Philadelphia, PA 19106-1797 Re: 2:10-cv-00179-MSG Please find hand delivered for filing in above docket, (1) PLAINTIFF LORRAINE GRINAGES COMPLIANCE WITH HONORABLE MITCHELL S. GOLDBERGS ORDER OF MAY 10, 2010 SUBMITS PHOTO VIDEO AND WITNESS EVIDENCE DEFENDANT SAUNDRA O. SULLIVAN HAS LIED TO U.S. MARSHAL TO EVADE SERVICE OF SUMMONS AND RESIDES AT 972 ANCHOR STREET, PHILADELPHIA, PA 19124 WHERE SHE WAS PRESENT ON JUNE 8, 2010 AT 6:30 P.M. 45 MINUTES BEFORE SAUNDRA O. SULLIVAN PARTICIPATED IN SIX MEMBER FLASH MOB WITH GUNS AND BASEBALL BATS ATTEMPTED HOME INVASION AND INFLICTED AGGRAVATED ASSAULTS OF LORRAINE GRINAGE, ROXANNE GRINAGE AND WILLIE BROWNSON ENDANGERING LORRAINE GRINAGES CHILDREN TRANSPORTED AND LEFT UNATTENDED IN SAUNDRA SULLIVANS WHITE BRONCO IN THE MIDDLE OF FLASH MOB VIOLENCE with (2) Certificate of Service, (3) Exhibit A, (4) Notice of Change of Address and (5) Respectful request Clerk of Court correct spelling of minor Plaintiffs middle name Ezekiel Zadkiel Brown and do not file Plaintiffs Compliance as an amended complaint.  https://docs.google.com/viewer?a=v&pid=explorer&chrome=true&srcid=0BwkY4FQWX-6pMTliNWMzZDYtYjM5YS00NWFjLWFkMDAtOTAwODcxODhhNGI2&hl=en_US

Roxanne Grinage PO Box 22225 Philadelphia Pa 19136 Direct Dial Cell (267) 444-0594 Fax: (215) 405-2939 roxannegrinage@yahoo.com www.HireLyrics.org www.Facebook.com/Roxanne.Grinage www.Twitter.com/HireLyrics www.YouTube.com/HireLyrics www.Youtube.com/WhatIsThereLeftToDo www.YouTube.com/RoxanneGrinage www.BlogTalkRadio.com/Born-To-Serve Roxanne Grinage Resume Baby Shower Grandchildren Stop Free Work at 1060th Federal Crime Victim Claimant Verified.

Roxanne Grinage Job Interview Funding Pitch American Jobs Creation Societal Preservation

Roxanne Grinage
PO Box 22225, Philadelphia Pa 19136
Direct Dial Cell (267) 444-0594      Fax:  (215) 405-2939
roxannegrinage@yahoo.com
www.HireLyrics.org        www.Facebook.com/Roxanne.Grinage
www.Twitter.com/HireLyrics                    www.YouTube.com/HireLyrics
www.BlogTalkRadio.com/Born-To-Serve

Re:  Expressing interest in administrative support / staff employment

 

WHO I AM.       I am a community conscience baby boomer who constantly applies ingenuity and passion to make this world a better place.   I possess more than 20 years experience as both an employee and self employed consultant legal administrative assistant, human resources assistant, executive assistant loyally adept in providing administrative, document production, marketing, careers and due diligence reporting support to large mid-size sole practitioner law firms, staffing firms, investment banking mergers and acquisitions and, what I am most proud of… administrative solutions for market entry challenges of American working class student and impoverished families victimized by official corruption fraud civil rights violations.

 

June 2000, I started my own self employment interest which Wharton Small Business Administration nominated in 2001 for Philadelphia 100 recognition as an invention in business method.  My administrative assistant support skills and exemplary work ethic were honed working for attorneys, analysts and executives at firms like Wolf Block, Dechert, Blank Rome, Buchanan Ingersoll, Legg Mason Wood Walker, Citicorp U.S. Cards Products, Nynex Governances and Securities, Coopers & Lybrand Tax Department and CDI Staffing giants CDI Engineering and CDI Information Technology Divisions. 

 

I was fortunate because I received a whole lot of guidance from a few attorneys I was working for as a second shift secretary floater at Blank Rome, Wharton MBA students and even a Wharton board member, founder of Encore Books Zainy Brainy Stores and co-founder eBay and Half.com with regard to understanding Overview and Rationale, depicting and demonstrating envisioned evolving practice models for what in my mind was an obvious working scale model prototype demonstration that standard access to standard services which utilized free and low cost internet networking capabilities would unlock economy enriching revenue in an a previously untapped population of litigants ─ if the disadvantaged claimant could access research, legal secretarial, document production, marketing and careers services regardless of who they knew or what the claimant had.

 

2003 – 2007 I, as manager of Pennsylvania Secretary of State and U.S. Department of Treasury registered sole proprietorship earned Womens Minority Business Enterprise expert certifications in nine areas of administrative practice:  Legal services including evidence gathering, depositions and expert witness testimony; employment generating activities; employee development; careers consulting; employee assistance programs; tax preparation and advisory services; and image consulting.

 

WHAT I DID.  August 2009 to Present.  I knew about and chose to embrace problem solving challenges faced by American working class student and impoverished families and entrepreneurs as a liquid demographic whose economic impacts have measureable characteristics flowing throughout every profession, race, gender, religion, region, age, lifestyle; and whose untapped claims for damages, personal injury, wrongful death, forced commerce, theft and irreparable harms are felt generationally as a nationwide Child Slaughter, U.S. Economy Fraud, Court and Education Reform Public Safety Emergency.

 

Even before my own official corruption fraud civil rights victimization recorded in Roxanne Grinage v Fern Brown Caplan, Esquire, et al, U.S.D.C. 209-cv-04119-MSG,  I constantly learned and applied technology and protocols necessary to guard integrity of document production as evidence gathering depositions and expert witness testimony for what HireLyrics’ earliest invention of business method practice model schematics referred to as “raised quality of life by providing fair and holistic entry to exposure and earnings opportunities for the previously unseen unmeasured un-accommodated Worldwide Population of Disadvantaged Creators© of original creative work products.” 

 

I am proud that when faced with being blackballed for employment by some of the corrupt lawyers and judges whose RICO and Title 18 indictable crimes my administrative solutions tools exposed for deliberate malpractice ─ I chose to parlay a potentially life destroying challenge into an opportunity to demonstrate free and low cost standard access to legal administrative assistant services for a financially devastated population of internet presenting official corruption fraud civil rights claimants.

 

I am proud of my document production work; forms designed to accommodate standard access to claims intake assessment regardless of who the presenting claimant knows or what the presenting claimant has.  I customize existing templates and create new forms templates to identify characteristics of similarly situated classes of claimants; perform docket analysis for measuring individual accountability for official corruption fraud civil rights, Title 18 and RICO culpability, and for gauging specialized voter constituency endorsement and impeachment clout. 

 

I have produced pro se parties-filed documents, marked exhibits and exhibits summation of complaints, summons, subpoenas, notice of appeal, answers, new matters, counterclaims, motions, motions court correct administrative errors, grandparent motions to intervene, objections, affidavits, declarations and disclosures, filed by pro se parties in Pennsylvania Court of Common Pleas Family Division, Pennsylvania Superior Court, U.S.D.C. Eastern District of Pennsylvania, Third Circuit Court of Appeals, Michigan Washtenaw County Juvenile Trial Court, Cowlitz County Superior Court Washington, Alaska Superior Court at Palmer CINA; and many others examples of my work can be seen and downloaded free at http://hirelyrics.org/roxannegrinageresume.html. 

 

Another administrative solution tool I am proud of is working to measure work ethic synergy and intent; identify and measure individual accountability, conflict of interest, negligence or malpractice, registered with Pennsylvania Secretary of State, is U.S. Citizens (controlled) Public Docket Database whose prototype demonstration of certified service distribution (Letter Notice) reporting of Fraud Reports Whistleblower Transmittals Intervention and Audit Requests, case studies are viewable at www.HireLyrics.org.

 

I am most proud of my demonstrated administrative solutions case studies series, “Docket Never Lies!...Child Slaughter U.S. Economy Fraud Court and Education Reform Public Safety Emergency Is Measured in Docket Analysis”, began when I utilized the database features of rows columns and tables learned when I was employed as a document production specialist by firms like Wolf Block, Dechert, Blank Rome, Buchanan Ingersoll, Legg Mason Wood Walker, Citicorp U.S. Cards Products, Nynex Governances and Securities, Coopers & Lybrand Tax Department and CDI Staffing giants CDI Engineering and CDI Information Technology Divisions.

 

WHAT I’M LOOKING FOR. Effective November 15, 2011.  I am looking for a long term or permanent “home” with an employer whose mission is to deliver best quality products and services; like myself, committed to being part of America’s quality of life enhancing solutions in economy, education, litigation, environmental protection, and public safety.  I am seeking to be taken seriously as a competitive but manageable employee who is loyal to her employers’ confidentiality, non-compete, conflict of interest considerations.

 

I was reminded there are many integrity and ethics driven practices, groups, organizations and companies who also offer compensable employment opportunities, as I performed consultant proprietary research and authored strategy planning pitch book presentation for one of the Iviewit Technologies Inventors, Eliot Ivan Bernstein. 

Assessment of market-entry challenge started with a need to galvanize legal industry scholars for moving forward stalled $1 Trillion Patent Theft and RICO claims and grew to a recognition of a three prong marketing initiative, generational community development career paths growing in academia, litigation, public safety, environmental protection, technology, economy, court reform and constitutional law enforcement.

 

The pitch book presentation is forty pages, titled 11/11/11 Roxanne Grinage HireLyrics respectfully suggested administrative solutions Build This Schematics Iviewit Technologies Fight For The Grail Births EIBCSB Estate Heirs Community Generational Career Paths Growing.pdf and can be viewed by typing any combination of these words into internet search engines, now published by at least one investigative journalist in addition to being published with other examples of Roxanne Grinage’s work at http://hirelyrics.org/roxannegrinageresume.html.

On November 14, 2011 I verified by standard access claims intake assessment the 1,060^th Federal Crime Victim with verifiable evidence of official corruption fraud civil rights claims; a resident of Anchorage, Alaska, having official corruption fraud civil rights claims spanning Hawaii, military and Olympia, Washington jurisdictional challenges.

 

While “make this world a better place” work continues to be my objective, my daughter’s official birth announcement of my grandson, Grayson’s arrival in December, 2011, requires me to insist my work product contribution be reciprocated with dependable regular paid compensation so that I honor my new grandchild’s brother and sister Ezekiel Zadkiel Brown and Arriyel Roxanne Brown who were abducted on June 8, 2010 by a public mob assault led by their father Erick Brown and his girlfriend Saundra O Sullivan’s family, now federal and municipal fugitives harbored by nepotism corruption of a few City of Philadelphia elected officials.

 

One part of me is regretful but other parts of me are exhilarated looking forward to unknown challenges and accomplishments promised by my accepting that I can no longer afford to provide free professional services no matter how worthy the need. 

 

I am eternally grateful to the 1,060 Federal Crime Victim Claimants who allowed me to demonstrate standard access to legal administrative assistant video talk radio citizen journalism administrative solutions for healing a nationwide Child Slaughter U.S. Economy Fraud Court and Education Reform Public Safety Emergency.

For this expression of interest, I have attached my short form resume.  Full Chronological listing with references and direct contacts of prior employers is nine pages and will be promptly provided upon request.  Please contact me if you have interest. 

Sincerely,

/s/
Roxanne Grinage

Roxanne Grinage
PO Box 22225, Philadelphia Pa 19136
Direct Dial Cell (267) 444-0594    roxannegrinage@yahoo.com

Objective:         An accomplished and twenty years qualified professional with strong knowledge of legal services evidence gathering case study internet marketing and whistle blower reporting principles seeking a position in an organization to utilize my skills and passion for the field of corruption in government clean up initiatives or any of the administrative support practice areas for which I am 2003 through 2007 Pennsylvania Bureau of Contracts Administration Minority Women Business Enterprise certified expert: Legal Services including evidence gathering depositions and expert witness testimony; employment generating activities, employee development and career consulting, employment assistance programs, tax preparation and tax advisory services, image consulting.

June 23, 2000 to Present.  HireLyrics Administrative Services:  Owner and manager of an eleven plus years Pennsylvania Secretary of State and U.S. Department of Treasury registered Wharton Small Business Administration recognized invention of business method, HireLyrics Administrative Services, whose internet marketing careers label stores practice models demonstrate “The answer to missed educational opportunities, oppressive contracts, un-accountability horror stories, racism, poverty and hate-based ideas festering into terrorism is the responsible development of entities that standardize access and standardize services.” 

Demonstrated Core Competencies:

·         Excellent Administration Skills;

·         Competitive responsiveness to employer or client expressed objectives;

·         Strategy Planning and Presentation;

·         Excellent Leadership and Managerial Skills;

·         Proprietary Research.  Claims Intake Assessment;

·         Compliance with client or employer expressed confidentiality, non-compete preferences;

·         Identify record track and report synergetic and conflict of interest relationships;

·         Forms Design and Forms Compliance;

·         Client Matter File Creation, Time Entry, Billing, Invoices, Scanning, File Management;

·         Pro Se Court Rules Compliant Document Production;

·         Certified Services Distribution of Fraud Reports, Whistleblower Transmittals, Intervention and Audit Request by due diligence pitch book presentation or Letter Notice to U.S. Senate Committees, U.S. Dept of Justice, President Executive Officers, U.S. Courts Administration, States legislators, lawmakers, special prosecutors and funding source decision makers;

·         Records Management and Case Study Analysis;

·         Trial Prep, Discovery, Exhibits Index, Exhibits Summations, Exhibits Binders;;

·         PowerPoint to JPEG or GIF Graphic Depiction of any Process or Goal Model

·         Overview and Rationale “Best Pitch Proposal” Reports;

·         Public Relations and Promotional Writing;

·         Website and ecommerce management (using templates and a little html);

·         Video Citizens Journalism, Blog Writer, Internet Talk Radio Show Host;

·         Applications and comfortable learning new technology:  Microsoft Office Word PowerPoint Excel, Outlook, GroupWise and other internal email programs; WordPerfect; iManage, PC World Docs, Pro Law, Soft Scan, Dragon Naturally Speaking Premium Speech to Text; Styles, Numbering Schemes, Document conversion, blackline/redline track mark changes; Typing 70wpm accurate; Speedwriting 70wpm; Dictaphone tape and digital databank dictation transcription.

Organized and self-initiated; work with minimum supervision.  Also a real team player, always offer help as needed to any of my co-workers: telephone coverage, meeting and conference room facilitation, photocopies, whatever is needed.